PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco001683.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family WOX
Protein Properties Length: 260aa    MW: 28496.8 Da    PI: 6.5111
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco001683.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox49.76.3e-163292257
                 T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
     Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                 r+R+t+++eq+ +Le+ F++   +p +ee  ++ k l    ++ +++V++WFqNrR + ++
  Aco001683.1 32 RSRWTPKPEQILILESIFNSgMVNPPKEETVRIRKLLerygSVGDANVFYWFQNRRSRSRR 92
                 89*****************99*************************************997 PP

2Wus_type_Homeobox107.96.2e-353194265
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       +r+RWtP+peQi iLe++++sG+++P+kee+ ri++ Le+yG ++d+NVfyWFQNr++R+r++q
        Aco001683.1 31 VRSRWTPKPEQILILESIFNSGMVNPPKEETVRIRKLLERYGSVGDANVFYWFQNRRSRSRRRQ 94
                       589***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.2722893IPR001356Homeobox domain
SMARTSM003892.4E-73097IPR001356Homeobox domain
SuperFamilySSF466893.08E-1430100IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.9E-93299IPR009057Homeodomain-like
PfamPF000461.1E-133292IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009734Biological Processauxin-activated signaling pathway
GO:0048830Biological Processadventitious root development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
HLFPMDDHNR NHINNTHNSG SAYDRDTAGP VRSRWTPKPE QILILESIFN SGMVNPPKEE  60
TVRIRKLLER YGSVGDANVF YWFQNRRSRS RRRQRQMQAA AALNNPAGGA CAQLGGASLC  120
DPNALSSGYS NNGNFFSCSS ASSASSATAS SSNFIGDDSD DLFAISRQMG YMESKSQVPT  180
YMCSTPEVSQ LQYQPGTITV FINGLPTEVP SGLIDMRALF REDAVLVNTS GELLPINEYG  240
ILMQSLQMGE SYFLVSRPT*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00330DAPTransfer from AT3G03660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008781305.15e-87PREDICTED: WUSCHEL-related homeobox 6-like isoform X1
RefseqXP_008781307.15e-87PREDICTED: WUSCHEL-related homeobox 6-like isoform X2
SwissprotQ6X7J32e-68WOX11_ARATH; WUSCHEL-related homeobox 11
TrEMBLM0SD631e-78M0SD63_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr3P09460_0014e-78(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP107837109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03660.13e-32WUSCHEL related homeobox 11